SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr1g067180.4 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr1g067180.4
Domain Number 1 Region: 18-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.31e-19
Family Glutathione S-transferase (GST), N-terminal domain 0.0021
Further Details:      
 
Domain Number 2 Region: 103-207
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.15e-17
Family Glutathione S-transferase (GST), C-terminal domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr1g067180.4
Sequence length 216
Comment | glutathione S-transferase tau | HC | chr1:28923571-28921512 | 20130731
Sequence
MATIGVKPVLPPPLTSTSQPPPLFDGTTRLYVSYSCPFAQRTWITRNYKGLQNNIHLVPI
DLQNRPAWYKEKVYPENKVPSLEHNGKVLGESLDLIKYIDANFDGPPLFPNDPAKKEFAE
QLLSHVDTFTKELFVSLKGDTVQQSSPTFEFLENALGKFDDGPFLLGQLSLVDIAYIPFV
ERFHIVLAEVFKHDITEGRPKLATWIEVHSLEELLV
Download sequence
Identical sequences A0A072VJT4
XP_013468272.1.50012 Medtr1g067180.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]