SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr1g075320.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr1g075320.1
Domain Number 1 Region: 53-279,394-466
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.17e-76
Family Bacterial dinuclear zinc exopeptidases 0.000066
Further Details:      
 
Domain Number 2 Region: 272-385
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 1.15e-18
Family Bacterial exopeptidase dimerisation domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr1g075320.1
Sequence length 469
Comment | N-carbamyl-L-amino acid amidohydrolase | HC | chr1:33349314-33344713 | 20130731
Sequence
mvhhyhyvivllllfftsisshqhhdhdhdpsiistmeqfsgysileptsfsslsydaqa
lqnqidelsgfsdapapsvtrvlytdkdvlarryvknlmgiaglsvredavgnifgrwdg
sepglaavatgshidaipysgkydgvvgvlgaveaisvlkrsgfkpkrslevilftseep
trfgisclgsrllagsenlanslktitdsqnvsfldaarsagyardeddlssvflkkgty
safielhieqgpiledegisigivtaiaapaslrvefegngghagavlmpnrndaglaas
elalavekhvlesgsvdtvgtvgilqlhpgainsipskshieidtrdideerrnqvieki
hetairitktrgvkltefhiinqdppalsdeavvnametatkelnltsklmisrayhdsl
fmarvspmgmifipcykgyshkpeefasikdmsngvkvlaftlaklslq
Download sequence
Identical sequences G7I3Z0
XP_003590793.2.50012 Medtr1g075320.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]