SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr1g081665.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr1g081665.1
Domain Number 1 Region: 431-685
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.72e-68
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 88-172,204-231
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000275
Family alpha-D-mannose-specific plant lectins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr1g081665.1
Sequence length 697
Comment | Serine/Threonine kinase domain protein | LC | chr1:36316470-36310683 | 20130731
Sequence
MTLLLQMAINYGSLPFQIQAGIYRKKKKKKICRWKILTTSTTTSLYVNATNDSLKPGDTF
NSNSTLCSKQGKYCLELRRYLIVIDVNGTVVWFYDRNHPFDSEEDSTVLSLDYSGVLKIE
CQDRKPMIIYTSPQPNNNTVATMLDTGNFLLQQLYPNGTKSILWQSFDYPTNFLIPTMKL
GVNRKTGHNWSLVSWLTPLLQTSGEFSLEWEPKQGELNIKKRGKVYWKSGKLKSNGMFEN
IPVNVQHMYQYIIVSNKNEDSFAFELSSKGKLTSGVEDNASGEIGNADICYGYNSNGGCQ
KWEDIPTCREPGEVFQKKVGTPKSKMDNASSYEWNVIYGYSDCKMRCWRNCSCNGFVELY
DNLTGCVFYSWNSTQDVDLDSQGNFNVLVMPTKSALHKKNKRKEGKSEHLADSNESYDIK
DLEDDFKGHDIKVFNFATILEATMNFSPENKLGQGGYGPVYKGILATGQEVAMKRLSKTS
GQGIVKFKNELVLICELQHTNLVQLLGCCIHEEERILIYEYMPNKSLDFYLFGISQGLLY
LHKYSRLKIIHRDLKASNILLDENMNPKISDFGMARMFTQQESTVNTNRIVGTYGYMSPE
YAMEGICSTKSDVYSFGALLLEIAWELWNDGEYLKLMDPTLNDTFAPEQYANDRPTMSDV
ISMLTNKHELPTSPRRPATPILQQQFLHHVKLKQKYK
Download sequence
Identical sequences A0A072VMI6
XP_013469005.1.50012 Medtr1g081665.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]