SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr1g088400.2 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr1g088400.2
Domain Number 1 Region: 50-232
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.15e-60
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.00000246
Further Details:      
 
Domain Number 2 Region: 3-48
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 0.000000103
Family Domain of poly(ADP-ribose) polymerase 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr1g088400.2
Sequence length 244
Comment | poly [ADP-ribose] polymerase | HC | chr1:39514562-39518688 | 20130731
Sequence
MREFVIDTPQKLIHKLEMVEALAEIEVATKLLKDDAEMQGDPLYAYYKCLRCELVPVESG
TEEFSMIESYMMNTHAKLHSDYTVEIVQIFRTSKEGEAERFRKFSNTKNRMLLWHGSRLT
NWTGILSQGLRIAPPEAPVTGYMFGKGVYFADMFSKSANYCHPTPTAADGVLLLCEVALG
EMAELLTGDHDADRLPEGKLSTKGVGATAPDFSKAQELEDGLIVPLGKPKTNSRIKLQGN
LIAQ
Download sequence
Identical sequences A0A072VP63
XP_013469180.1.50012 Medtr1g088400.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]