SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr1g092920.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr1g092920.1
Domain Number 1 Region: 56-145,288-513
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.59e-110
Family Bacterial dinuclear zinc exopeptidases 0.00034
Further Details:      
 
Domain Number 2 Region: 146-287
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 7.14e-36
Family Aminopeptidase/glucanase lid domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr1g092920.1
Sequence length 526
Comment | aspartyl aminopeptidase-like protein, putative | HC | chr1:41854955-41849099 | 20130731
Sequence
MASTITRPHILLLHSSSPSLKLNLKPSSPFLRYRNLPNSSPFIPRRVFCSTNSTSSKSQS
ASIVNDLLDYLNESWTHFHATAEAKRQLIAAGFHLLNENEEWNLKPGGRYFFTRNMSCLV
AFAVGQKYDVGNGFYAIAAHTDSPCLKLKPKTASLKASSYMMVNVQTYGGGLWHTWFDRD
LSVAGRVILKRSDKSFVHKLVKVSRPILRIPTLAIHLDRTVNQDGFKPNFETHLLPLLSM
KLEDTSAESKEKTAKLSSKASHHPLLMQILSEELKCDVDEIVSIELNVCDTQPSCLGGAN
NEFIFSGRLDNLASSYCALRALVDSSESPDDLASEQAIRMVALFDNEEVGSDSAQGAGAP
TMFQAMRRIVASLANSYVGEGSFERTIRQSFLVSADMAHGVHPNFADKHEEHHRPELQKG
LVIKHNANQRYATSGITSLLFKEVGKIHNLPTQEFVVRNDMGCGSTIGPILASGVGIRTV
DCGIAQLSMHSIREICGKEDIDIAYKHFKAFYQNFSSIDKMLTVDS
Download sequence
Identical sequences G7I369
XP_003591776.2.50012 Medtr1g092920.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]