SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr2g017825.6 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g017825.6
Domain Number 1 Region: 155-309
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-42
Family Protein kinases, catalytic subunit 0.00036
Further Details:      
 
Domain Number 2 Region: 42-132
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.82e-25
Family Ankyrin repeat 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr2g017825.6
Sequence length 321
Comment | integrin-linked kinase family protein | HC | chr2:5510951-5515496 | 20130731
Sequence
MESKNPARFKLGKQSSLAPERHSEEDEVHHDGAATIDPGVRLMYSANEGDVDGIREVIES
GVSVNFRDVDGRTALHIAACQGLSHVVQLLLEKGADVDPKDRWGSTPLADAIFYKNKDVI
KLLENHGAKPLMSSMHVNHAREVPEYEINPKELDFTNSVEITKGTFCLALWRGTEVAVKK
LGEDVSSDEEKVKAFRDELALFQKIRHPNVVQFLGAVTQSTPMMIVTEYLPKGDLRDFMK
RKGALKPSTAVRFALDIARGVGYLHENKPSPIIHRDLEPSNILRDDSGHLKVADFGVSKL
LANKEDKPLTCQETSCGCCFS
Download sequence
Identical sequences A0A072VEQ5
Medtr2g017825.6 XP_013462625.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]