SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr2g018880.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g018880.1
Domain Number 1 Region: 783-876
Classification Level Classification E-value
Superfamily BRCT domain 1.45e-22
Family BRCT domain 0.0025
Further Details:      
 
Domain Number 2 Region: 4-74
Classification Level Classification E-value
Superfamily RING/U-box 2.87e-19
Family RING finger domain, C3HC4 0.0035
Further Details:      
 
Domain Number 3 Region: 892-1004
Classification Level Classification E-value
Superfamily BRCT domain 0.0000017
Family DNA topoisomerase II binding protein 1, TopBP1 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr2g018880.1
Sequence length 1006
Comment | breast cancer susceptibility-like protein, putative | HC | chr2:6018865-6024557 | 20130731
Sequence
MGDLEKMGRELKCPICLGLLHSAVSLTCNHLFCNSCIFKSMKSASSCPVCKIPFTRREVR
PAPHIDNLVTIYKNMEAASGINLFGTQNPTATKSPDDEMQGGGDAESGEKGIGGTHENHA
EEEKTPTRKRSRKKLKTSTISSEKLKTSRKSPASNRAKPSFPAKKRVQVPQDILSETPLR
NLKTGGSITQVNKEGTQEASIKRNVSAIGSEKRDQVKEPFFWLREEQDGERLSAQTDEDQ
IIEGPTPIPPSFSDLKDADDESPLKQAPSDEVQNKPSVDLFDSEFFEWTQKPCSPELFSS
PIKTQVEDTDEIDENIEEWVAALQEKQTSVDACNTNFENPNGNQLAEALLPGLSSEIRSS
DDLNGKKNSTKRSRKAREKSRQDHIRELNCLSDEINMDADITSKVIEEQSLDYKHKASNL
KKSNKRGKKVSFVTSTESTPPIACTVSNILGVQNIGDRKTAKNSYTSESKQDNEMQFPEK
IAGKRQVRRSGKQRLDVVDDPPEDLTSVQNQCKELAGSASSSLRLQMDSNRNTVNTRKRK
SSLSRKSTPSVTERKSTKKSKLSPEFISRTKNGEEIKPTGSTNPGTDVRPLNDSSKEKHC
SLTDQPVLRKCVSHAKEYQCAFCLSSEESEASGPMVHYFDEKPVTADFEGGPKVIHCHRN
CTEWAPNVYFEDDNAINLEAEISRSRRIKCGFCGLKGAALGCFEKSCRRSFHVPCAKWTP
ECRWDMENFVMLCPLHAPSLLPCESSGSQHNSKKHTAKKVKICSRKHDTTSQSQIAHGSH
KKIVLCCSALSVQEKEVVSEFERVSKVTVLKTWDSGVTHVIASTDENGACRRTLKVLLGI
LEGKWILSIEWIKACMKETRPVDEERYEVNVDIHGIKDGPRLGRLRVVNKQPKLFDGYKF
YFMGDFIPSYKGYLQDLVIAAGGIVLHRKPVSADQNEILPTMNQHRTLIIYSLELPAKSN
PLEKDAIFSQRRCDAEALARPTCSKVASNTWILNSIAGCKLQSLAQ
Download sequence
Identical sequences A0A072V4U2
XP_013462656.1.50012 Medtr2g018880.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]