SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr2g035405.3 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g035405.3
Domain Number 1 Region: 42-267
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.47e-53
Family Bacterial dinuclear zinc exopeptidases 0.00025
Further Details:      
 
Domain Number 2 Region: 257-345
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 4.36e-16
Family Bacterial exopeptidase dimerisation domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr2g035405.3
Sequence length 352
Comment | allantoate amidohydrolase | HC | chr2:15135021-15130281 | 20130731
Sequence
MISTFIFFHSFLFLYILSTPSSCSSFLSGIETGDLEKRGDLFPQILRDEAVARLVELGKV
SDANDYLERTFLSPATTRAINLIRKWMEDAGLRTWVDQMGNVHGRVEGANANAEALLVGS
HMDTVVDAGKFDGALGIVSAISALKVMHVNGKLQNLTRPVEVIAFCDEEGVRFQTTFLGS
GALAGILPATTLEIPDKRNVTVKDVLKENSIEAAEEMFLQLKYDPKSVWGYVELHIEQGP
VLEQVGFPLGVVKGIAGQTRLKVTVRGSQGHAGTVPMSMRQDPMVAAAEQIVLMESLCKH
PEEYLSYDGRCSGSSIKSLSSSLVCTVGEISTWPSASNVIPGQASDEFPKSC
Download sequence
Identical sequences A0A072V6E4
XP_013463122.1.50012 Medtr2g035405.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]