SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr2g038030.2 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g038030.2
Domain Number 1 Region: 185-443
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 1.37e-46
Family ATP-dependent DNA ligase catalytic domain 0.00038
Further Details:      
 
Domain Number 2 Region: 449-598
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.94e-26
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.001
Further Details:      
 
Domain Number 3 Region: 653-734
Classification Level Classification E-value
Superfamily BRCT domain 4.8e-19
Family DNA topoisomerase II binding protein 1, TopBP1 0.046
Further Details:      
 
Domain Number 4 Region: 5-209
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 0.00000196
Family ATP-dependent DNA ligase DNA-binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr2g038030.2
Sequence length 814
Comment | DNA ligase | HC | chr2:16517930-16532770 | 20130731
Sequence
MTELTKFSVLCSLFTWTQRTKAPAKKRAKFRKFLDNFCTDRNYFPAIRLILPNLDRERGS
YGLKESVLATSLIDALGMAKDSHDALRLVNWRKGGAKTGANAGNFALVAAEVLQLRQGTA
SGGLTIKELNDLLDQLSSSENRGEKTLVLSTLIQKTNALEMKWIIMIILKDLKLGISERS
IFHEFHPDAEDLFNVTCDLKLVCEKLRDRNQRHKRQDIEVGKAVRPQLAKRVANAADAWK
KLHGKEVVAECKFDGDRIQIHKNGTEIHFFSRNFIDHSEYAHGMSEIIIQNILVDRCILD
GEMLVWDTSLNRFAEFGSNQEIAKAARDGLESNRQLCYVAFDILYFGDTSVIHQTLKERH
EILRKVVKPLKGRFEILLPNGGINNHRSSGEPCWSFIAHNAEEVERFFKETIENREEGIV
VKDLSSKWEPSDRSGKWLKLKPDYVHAGSDLDVLIIGGYYGSGRHGGEVAQFLVGLAERP
SPNTHPKRFISLCRVGTGLSDDELEAVVTKLKPYFRKYPKTSPPSFYQVTNHSKERPDVW
VDSPEKSIILSVTSDIRTIESEAFAAPYSLRFPRIDRVRYDKDWHECLDVQSFIELVQSG
NGTTQRNTEYGSNKDSKPKRMKSSTRGEKKNMSTVPSHLSQTDVSSVTGGSLMFSNMMFY
FVNVPPSHSLESFHKLVAENGGTFSMNLNNAVTHCVAADSKGFKFEAAKRRGDIIHYTWV
LDCCAQKKLIPLHLKYFLFLSELTKKKLQEDIDEFSDSYYLDLDLGDIKQLLSNINRSED
VSTVDHYRKKYCPKDKWSIFNGCSIYFRTTMPSL
Download sequence
Identical sequences A0A072V5Z6
Medtr2g038030.2 XP_013463409.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]