SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr2g063913.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g063913.1
Domain Number 1 Region: 130-297
Classification Level Classification E-value
Superfamily HAD-like 4.69e-33
Family NLI interacting factor-like phosphatase 0.0095
Further Details:      
 
Domain Number 2 Region: 215-231,354-438
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000000393
Family DNA topoisomerase II binding protein 1, TopBP1 0.031
Further Details:      
 
Weak hits

Sequence:  Medtr2g063913.1
Domain Number - Region: 311-374
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 0.0366
Family Initiation factor IF2/eIF5b, domain 3 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr2g063913.1
Sequence length 446
Comment | carboxy-terminal domain phosphatase-like protein | LC | chr2:27079146-27073853 | 20130731
Sequence
MSHDETEFPDSTDSSGSTDEFIQNLEDELDDDGSDNSSSDEEAESEDSRIKRLKSDSTSE
TETSTSAGTAEQKLVSSVNVDVCMHPGSFGGICIHCGQKVDGESGVSFGYIRKGLKLDDK
EISRVRGIDVKNLLNRRKLCLVLDLDHTLLNTTSLHRLSPEEMHLKTHTDSLEDISKGSL
FMLAHMQVMTKLRPFVRTFLKQASEMFEMYIYTMGDRQYSLEMARLLDPQEEYFKDKVIS
REDGTQKNVKDLDLVLGTENSILILDDKEEVWPKYRDNLILMERYHFFNSSCQDFGLQRK
SLVALHIDENETDGALAKILEVLRQINYKFFDELQGDLVDRDVRQVLSSFQGEVLRGCVI
IFSLNFRGDLRKLRRIAERLGATCLKKHDPTVTHVVATDFVTKESRWAVKEKKFLVNRRW
LEAANFFLQKQPEENFLCQNTLVSGN
Download sequence
Identical sequences A0A072V8S3
XP_013464182.1.50012 Medtr2g063913.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]