SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr2g064110.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g064110.1
Domain Number 1 Region: 3-65
Classification Level Classification E-value
Superfamily HAD-like 0.000000000338
Family NLI interacting factor-like phosphatase 0.022
Further Details:      
 
Domain Number 2 Region: 21-41,119-166
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000491
Family DNA topoisomerase II binding protein 1, TopBP1 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr2g064110.1
Sequence length 172
Comment | carboxy-terminal domain phosphatase-like protein, putative | LC | chr2:27152477-27153886 | 20130731
Sequence
MNKLRPFVRTFLKEASEVFEMYIYTMGIRQYSLEMAKLLDPQVEYFKDKVWQKHKDNLTT
FSIKVARKLTSISNSESAKTDQLKFFDVYLIRLRYFDNVISLLQSIHVFHVLSSLRGEVL
SGCVIVFSCAFHGHDLRKLRKIAERLGATHLTELRPTVTHVVANAFVTKESM
Download sequence
Identical sequences G7IGW5
Medtr2g064110.1 XP_003595954.2.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]