SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr2g090860.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g090860.1
Domain Number 1 Region: 11-93
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000000018
Family Protein kinases, catalytic subunit 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr2g090860.1
Sequence length 95
Comment | receptor-like kinase | HC | chr2:38998140-38998502 | 20130731
Sequence
MARQRRSKTWIPLSVSVATSHKMGKGTNNFDESWVIVGVGGFGKVYKRDLRDGRKVAVKR
GNPRLLQGIAEFRAEIEMLSQFRHRHLVSLIGYSL
Download sequence
Identical sequences A0A072VC83
Medtr2g090860.1 XP_013465181.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]