SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr2g100550.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g100550.1
Domain Number 1 Region: 327-569
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.76e-59
Family Protein kinases, catalytic subunit 0.00044
Further Details:      
 
Domain Number 2 Region: 45-162
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.3e-41
Family Bacterial dinuclear zinc exopeptidases 0.00000396
Further Details:      
 
Domain Number 3 Region: 177-245
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000000592
Family Polygalacturonase inhibiting protein PGIP 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr2g100550.1
Sequence length 610
Comment | tyrosine kinase family protein | HC | chr2:43224438-43219986 | 20130731
Sequence
MDFFKCVKLFIIMFISFLSATPIFSDSSSSSNAIPNFLELAKEPQVFDWMVDIRRKIHEN
PELGYEEFETSKLIRTELDELGVQYKHPVAVTGVIGYIGTGLPPFVALRADMDALLMQEL
VEWEHKSKVPGKMHACGHDAHVAMLLGAAKILKEHEKQLYEKIKTDNKVKKVCGLQTKNA
IELNLTSSGLIGTIASGISNLKSIEYLDLSNNNLTGAVPDFLSQPRFLRVLNLEGNQLSG
AIPIQLLVRSENSTLQFNFGGNQDLCSSGSCNKRNGNKVVVPLVTSIGGAFLILAVAAIS
FRIYNKRHHVSHKVIKLGANSRIKQELESKKQEFTYEEVLRITRNFEKVIGKGASGTVYH
GWIDHNTLSKCYLPYLLKDFFHHKYLTSLIGYCDDGTNMALIYYEYMANGDLANHLSDKN
ENILNWNQRLQIAVDTTVGLEYLHHGCNPPIVHRDVKSKNILLNDKLQGKLADFGLSKIF
PNEGETHLSIVIAGTPGYLDPEQVNTTPLREKSDVFSFGVVLLEIITGQPRGKRYFDTNY
ATKTLDTAMACVAQSSINRPTMRHVVMELKQCLENKITYPSDSRYTYESFPGTLYSVSFD
RISGESSIAR
Download sequence
Identical sequences G7IHX0
Medtr2g100550.1 XP_003597648.2.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]