SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr3g072590.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr3g072590.1
Domain Number 1 Region: 42-130
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000952
Family Thioltransferase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr3g072590.1
Sequence length 140
Comment | glutaredoxin 2 | HC | chr3:32662344-32660930 | 20130731
Sequence
mavaravavlavakpstvlaggvqtnrlhkfkplcfsttttspssrklilyskpgcclcd
glkeklqdafslsgphslndvdlqirditsnpewekayqyeipvlakvlsdgteetlprl
sprlgvellqkkiaaalgeq
Download sequence
Identical sequences G7J322
Medtr3g072590.1 Medtr3g072590.2 Medtr3g072590.3 XP_003601064.2.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]