SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr3g077040.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr3g077040.1
Domain Number 1 Region: 69-109
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.00000314
Family Bacterial exopeptidase dimerisation domain 0.00078
Further Details:      
 
Weak hits

Sequence:  Medtr3g077040.1
Domain Number - Region: 1-86
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.000248
Family Bacterial dinuclear zinc exopeptidases 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr3g077040.1
Sequence length 113
Comment | IAA-amino acid hydrolase ILR1-like protein | HC | chr3:34595422-34594501 | 20130731
Sequence
MHECGRDAHVVMLLGATKILKQHEKEIQVRSLICRQLKSKDIEGLENVFAIFELHIDLKL
PISEMESRSGKGGHAAIPQHFIDHILTASNVIIGSQHLVSREADPLDTQVNWR
Download sequence
Identical sequences G7J4S5
Medtr3g077040.1 XP_003601192.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]