SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr3g089065.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr3g089065.1
Domain Number 1 Region: 58-174
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.31e-41
Family Thioltransferase 0.0000489
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr3g089065.1
Sequence length 175
Comment | thioredoxin M-type protein | HC | chr3:40773453-40774783 | 20130731
Sequence
MALENCLRVSTARPQCLPSLFPTSREKVVFSAQRAGFKKSVLNSTLSFPSGVAYRKSRFI
CNAREAVNEVGAVTDSSWNELVLASDTPVLVDFWAPWCGPCRMIAPIIDELAKEYAGKIS
CYKLNTDENPNIATKYGIRSIPTVLFFKNGEKKESVIGAVPKSTLSTTVEKYIDA
Download sequence
Identical sequences A0A072VB76
XP_013461370.1.50012 Medtr3g089065.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]