SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr3g093040.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr3g093040.1
Domain Number 1 Region: 99-258
Classification Level Classification E-value
Superfamily NAC domain 6.54e-60
Family NAC domain 0.00000879
Further Details:      
 
Domain Number 2 Region: 1-84
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.57e-18
Family Bacterial dinuclear zinc exopeptidases 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr3g093040.1
Sequence length 312
Comment | M20/M25/M40 family peptidase | LC | chr3:42540067-42535957 | 20130731
Sequence
MHACGDDAHATMLLGAAKLLNRRKNKLKGTVRLLFQPAEKELEPRGASQERSRGASQMIK
EGVLQDVEAIFAVHTDATASTGNIASIPGPFTAAGCIFEMVTLSLISLPLGFRFRPTDEE
LIDYYLRLKINGNGDEVQVIREIDVCKWEPWDMPDLSVIKDNDPEWFFFCPQDRQYPNGN
RLNRETNHGYWKATGKDRKIKSGTILIGMKKTLVFYISRAPNGRRSNWVMHEYRPTLEEL
DGTNPGQKAYVLCRLFKKNDESLEVSNCGEGEQTNSAPEELQSDPAPITVSTSQVRQEDK
QQAVIPGISEEK
Download sequence
Identical sequences G7J929
XP_003602411.2.50012 Medtr3g093040.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]