SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr3g105400.2 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr3g105400.2
Domain Number 1 Region: 41-135
Classification Level Classification E-value
Superfamily BRCT domain 7.46e-21
Family DNA ligase 0.03
Further Details:      
 
Weak hits

Sequence:  Medtr3g105400.2
Domain Number - Region: 191-268
Classification Level Classification E-value
Superfamily BRCT domain 0.00174
Family DNA topoisomerase II binding protein 1, TopBP1 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr3g105400.2
Sequence length 524
Comment | BRCT domain DNA repair protein | HC | chr3:48606997-48602243 | 20130731
Sequence
MGGEGRVEVVSGKGCSRLFSSSIRNLQPLDQMSPVSSSPQLPSNAPFAGLVICVTGLSKE
ARNQVMEATERLGGQYSPNLHPQCTHLVVQSFGGRKFEHALKHGTKNGLFVVTLGWFVDS
VRKNVRLTESLYSLKSYGDNDMKLDDFRLLPGYTNAGNCLPARIHEIKHTHHAEEFRRFS
GAESNRSLDSSLSGCSIYVDPGISSELQNKVAETASREGASLADQWFVGCNVSHVVTEGT
SIQRYLGYSSNLITPVWILKTAKEKQVQRLVSMSVDLARQVGLMLDDISGKEIVKQKVHD
DLQGSKSEIGCKERQQIVNSAKNGVRSRRGRRMQTCQTPIRPITPNNLLDSICWSISEAT
STASIYTDSFSAEDPSENHTSIFFDAKGDGKDSDASFSHSTRPLTESEKSELIFKNHFLT
ILFPVDRFSEIGPSTRTLFSHNGFTCLQVLDHIHAFYQENMSSLEIDVAIHTDSRHADRL
RSVYSSKETAERGYVMLKRIEFLGSRTSFEMLKRVSGDNNSQCV
Download sequence
Identical sequences A0A072V254
XP_013461852.1.50012 Medtr3g105400.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]