SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr4g006120.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr4g006120.1
Domain Number 1 Region: 7-66
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000113
Family 7-Fe ferredoxin 0.0000948
Further Details:      
 
Weak hits

Sequence:  Medtr4g006120.1
Domain Number - Region: 47-108
Classification Level Classification E-value
Superfamily Fe-only hydrogenase 0.0732
Family Fe-only hydrogenase 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr4g006120.1
Sequence length 573
Comment | NAD(P)H-quinone oxidoreductase chain 4 | HC | chr4:509323-511218 | 20130731
Sequence
MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGCKRCESACPT
DFLSVRVYLGPETTRSMARAFLAQVYLIFMTNYFPWLTIVVVFPIAAGSLIFLFPHRGNK
VIRWYSISICLIDLLLTTYAFCYHFQLDDPLIQLTENYKWINFFDFYWRLGIDGLSIGPI
LLTGFITTLATLAAQPVTREYQLFYFLMLAMYSGQIGPFSSRDILLFFIMWELELIPVYI
LLFILYTAGGSVFLLMGILGIGLYGSNEPTLNFETLTNQSYPVALEIILYTAFLIAFAVK
SPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLVRINMELFSHAHSIFCPWLMILG
SIQIIYAASTSFGQRNLKKRIAYSSVSHMGFIILGIGSISDTGLNGAILQIISHGFIGAA
LFFLAGTSYDRLRLLYLDEMGGMAIPMPKIFTIFTILSMASLALPGMSGFVAELIVFFGI
ITSQKYLFMMKILITFVTAIGMILTPIYLLSILRQMFYGYKFFNTPNSYFFDSGPRELFI
SISILIPVIGIGIYPDFIFSFSVDKVEAILANF
Download sequence
Identical sequences G7JVM1
XP_003604161.1.50012 Medtr4g006120.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]