SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr4g023500.4 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr4g023500.4
Domain Number 1 Region: 10-184
Classification Level Classification E-value
Superfamily ADP-ribosylation 4.32e-45
Family Tpt1/KptA 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr4g023500.4
Sequence length 206
Comment | RNA 2'-phosphotransferase, Tpt1/KptA family protein | HC | chr4:7946448-7952031 | 20130731
Sequence
MLLFDICRTRILRHMASELKLNMRSDGFVNVNDLLKLNLKTFANIPLRSHTIDDIREAVR
KDNKQRFSLVEENGELLIRANQGHTTTAVETESLLKPILSAEEFPVCVHGTYKRNLDSIL
ASGLKRMKRLHVHFSRGLPTDGEVISGMRRDVNVLIYLDVRKALEEGMKLYISDNKVILT
EGFDGVVPSKYFQKIESWPGRQPIPF
Download sequence
Identical sequences A0A072UH50
Medtr4g023500.4 XP_013455041.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]