SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr4g026420.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr4g026420.1
Domain Number 1 Region: 33-78
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000609
Family 7-Fe ferredoxin 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr4g026420.1
Sequence length 88
Comment | photosystem I iron-sulfur center, putative | LC | chr4:9069828-9072166 | 20130731
Sequence
MKSILKYPLACIEDYHTGDLDSYKEGDEDDNGSYSIFDICIGCIQCVRLLPQEVDCVGCK
RCESVCLTDFLSVRVYLGPETTRSMGLA
Download sequence
Identical sequences G7JFW7
Medtr4g026420.1 XP_003605191.2.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]