SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr4g050960.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr4g050960.1
Domain Number 1 Region: 7-65
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 5.98e-16
Family 7-Fe ferredoxin 0.0000815
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr4g050960.1
Sequence length 81
Comment | photosystem I iron-sulfur center | HC | chr4:18088612-18088367 | 20130731
Sequence
MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGCKRCESACPT
DFLSVRVYLGPETTRSMGLAY
Download sequence
Identical sequences A0A0F6NLR0 A0A0F6NLY5 A0A0K0LWW4 A0A0K1Z9Q2 A0A109RSU3 A0A1J0I0E1 A2Q593 B1A985 H2BBP5 H2BBP7 H2BBP8 H2BBP9 H2BBQ1 H2BBQ2 H2BBQ3 H2BBQ5 W8CYB0
Medtr4g050960.1 XP_003606023.1.50012 YP_001381675.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]