SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr4g083390.2 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr4g083390.2
Domain Number 1 Region: 12-109
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000392
Family B3 DNA binding domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr4g083390.2
Sequence length 149
Comment | B3 DNA-binding domain protein | HC | chr4:32459282-32456816 | 20130731
Sequence
MQTGGIEPLTGEPYFHVVLSKTHLSTRYGMGPSSSICEELPSKEVPTILKYRGKSWGMTY
NGQNKTKQFDSVSWEKFAEDNYLKLGDACVFELMKNSEEEIVFKVQILRGEEEPILLSEF
PGTAEANLSWLEIHLPLWDCSRLQDTFVL
Download sequence
Identical sequences G7JHL4
XP_003607834.2.50012 Medtr4g083390.2 Medtr4g083390.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]