SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr4g094275.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr4g094275.1
Domain Number 1 Region: 33-116
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.44e-23
Family Chaperone J-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr4g094275.1
Sequence length 179
Comment | chaperone DnaJ domain protein | HC | chr4:37592734-37593635 | 20130731
Sequence
MNASSLTSNLSISNSKQFHHLSKQLRPSHVHFATISCRATKLVEETKNGSNFYKMLSVNP
KSATMEDIKRAYRSMALQYHPDVCHDPSMKEESTKIFVRLNAAYETLSNPMLREQYDSEL
GLRNNMMNNNNIVNEEIWRSRWQEQVVELKKRSNRRMEQRGRSWGSTSRMRTQSMKDRN
Download sequence
Identical sequences A0A072UZE7
XP_013457209.1.50012 Medtr4g094275.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]