SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr4g134360.2 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr4g134360.2
Domain Number 1 Region: 10-94
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.3e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.00014
Further Details:      
 
Weak hits

Sequence:  Medtr4g134360.2
Domain Number - Region: 91-138
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00578
Family Glutathione S-transferase (GST), C-terminal domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr4g134360.2
Sequence length 139
Comment | glutathione S-transferase, amine-terminal domain protein | HC | chr4:56253570-56256522 | 20130731
Sequence
MICFVDLNFEQGKRNLYSYWRSSCSFRVRIALNLKYDYKAVNLLKGEQSHPDFLQLNPVG
FVPVLVDGPAVIFDSFAIIMYLEDKFPQQHPLLPTDIHKRAINFQAVSIVSSSIQPLQNH
SFLMYIQKKVGLDEKLPWA
Download sequence
Identical sequences A0A072UUG8
XP_013458691.1.50012 Medtr4g134360.1 Medtr4g134360.2 Medtr4g134360.3 Medtr4g134360.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]