SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr5g004960.3 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr5g004960.3
Domain Number 1 Region: 368-602
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.49e-77
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.0000349
Further Details:      
 
Domain Number 2 Region: 41-170
Classification Level Classification E-value
Superfamily BRCT domain 5.89e-22
Family DNA ligase 0.076
Further Details:      
 
Domain Number 3 Region: 607-720
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 5.65e-18
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr5g004960.3
Sequence length 1105
Comment | DNA repair protein REV1 | HC | chr5:222979-208176 | 20130731
Sequence
MSLNSCKRASSSSDANRRKKKQQKTTTTTNQKTLGVAWGKNSSNSTKSPFSDVASYMTEK
NRKLHNQFNTEEASTSCGNPIFAGVSIFVDGFTVPSSQELRGYMLKYGGRFENYFSRHRV
THIICTNLPHTKLKNLRAFSAGLPIVKPTWILDSVASNRLLTWAPYQLHQLSNNQQPKLS
KFFTFTTTKNSEDSLCQVESDIEDSFISAGKSEGRHSSEVGDVVESSRQIITEADDNVSE
NTDAIMMEELLASAGIKCDEEDPVGGSNDAAKDEENIQGELESSCQEPSASVSSLRSVNE
IPTSASTKPSKQCHSTLSDPNFVENYFKNSRLHFIGTWRNRYRKRFPTFSTGFDNEISNI
NASSVYGNSVVIHVDMDCFFVSVVIRSHPELLDKPVAVCHSNNSKGTAEISSANYPARSY
GIKAGMFVRDAKALCPHLVIFPYNFEAYEEVADQFYSTLHRHCNKVQAVSCDEAFLDVTH
SKVEDPELLASSIRKEIYETTGCTASAGIAGNMLMSRIATRTAKPNGQYHITPERVEDHL
SQLPINALPGVGHALQEKLKKQNVQTCGQLMMISKVSLQKDYGMKTGEMLWNYSRGIDTR
LVGEFQECKSIGADVNWGVRFNDMKDCENFLTNLCKEVSLRLQGCGMQGRTFSLKIKKRR
KDADEPAKFMGCGDCENLSHSVTIPVATDNLEVLHRIAKQLFGNFYIDVKEIRGIGLQVS
RLESSKASKQEKYNLKSWVTSRSASMDKQKHPMGHDKQNMDGTSIHGCRDLRGSSVEKDN
NIQDNQASADRISTPPPLCHLDVEVIRNLPPEVFSELNEIYGGKLVDYITKGKGISESSS
SLQSSLLEKEATNKEKELLDVDPIPQKKPLSEIEVMQHEAEGGEVVPDLGSGPSCNVNPK
SSFEKDDLLPSSLSQVDGSVLRELPEDLKAVIVLQLPAHRRQDISSNVTLVPPSENHQVS
LGVKNSENLGSNVLNECLWAGNPPKWVEEFKMSSCLILNKLAEVYYKSGLTSTLSSVLHQ
IISEFHLLNLVHQISDDSVNIMCELLKQYIKMKIGKDIEEIYICFRLLKRFAAKSQLFLQ
VYNGVFPYLQEAVDDNYGGSLFITP
Download sequence
Identical sequences A0A072UNA5
Medtr5g004960.3 XP_013453297.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]