SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr5g010010.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr5g010010.1
Domain Number 1 Region: 76-232
Classification Level Classification E-value
Superfamily IpsF-like 4.45e-58
Family IpsF-like 0.00000862
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr5g010010.1
Sequence length 233
Comment | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | HC | chr5:2576265-2580932 | 20130731
Sequence
mssssltassysfpfttslksshpiplscsfplkhhtlhlksspslfvspsgaatpttsi
eidkspisatpsrvlpfrvghgfdlhrlepgypliigginiphdrgceahsdgdvllhcv
vdailgalglpdigqifpdsdpkwkgcdssvfvhesvrlmheagydignldatlilqrpk
lsphkdaikanlsallgvdasvvnikakthekvdslgenrsiaahtvvllmkk
Download sequence
Identical sequences G7KC04
Medtr5g010010.1 XP_003611062.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]