SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr5g031560.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr5g031560.1
Domain Number 1 Region: 7-55
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000634
Family Thioltransferase 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr5g031560.1
Sequence length 92
Comment | hypothetical protein | HC | chr5:13544826-13545210 | 20130731
Sequence
MYLGFKEELKELLGEGYYGKGGLPKVFIEKKYIGRVEEIQKLHDDKKLEKLLDCCERIDD
IEGGGSGCEACGDIKCSHCNENGIIRCSMCCF
Download sequence
Identical sequences G7JWA1
XP_003613004.1.50012 Medtr5g031560.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]