SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr5g065980.2 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr5g065980.2
Domain Number 1 Region: 10-170
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.51e-33
Family Universal stress protein-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr5g065980.2
Sequence length 177
Comment | adenine nucleotide alpha hydrolase superfamily protein | HC | chr5:27794739-27791300 | 20130731
Sequence
MSESGNLGVVVVAVDGSEESMNALRWALENLKLRSPAPDSTDAGSFIILHVQSPPSIATG
LNPGSIPFGGPSDLEVPAFAAAIEAHQKRITDSIFDHALGICSTFNTKVRTHVVVGDPKE
KICETVQDLHADVLVMGSRAFGPIKRMFLGSVSNYCAHHSECPVTIIKGKGGVNKGN
Download sequence
Identical sequences G7KBJ3
XP_003615271.1.50012 Medtr5g065980.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]