SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr5g076180.5 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr5g076180.5
Domain Number 1 Region: 4-99
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.000000000159
Family FHA domain 0.007
Further Details:      
 
Weak hits

Sequence:  Medtr5g076180.5
Domain Number - Region: 102-163
Classification Level Classification E-value
Superfamily BRCT domain 0.000103
Family DNA topoisomerase II binding protein 1, TopBP1 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr5g076180.5
Sequence length 544
Comment | NBS1 | HC | chr5:32446638-32440861 | 20130731
Sequence
MLTGCDVIVTKDKGVSRVHAEIVVNTMNMLNPLQNVRRHLSSSVQIRDCSKYGTFVSKNI
GSKKKVHELPNKETALQDGDLVSFGTGSATYKFCHVPLILFICSSNQVDRSLEEKISSIG
ASISHTLNEECTHVLVDQLMPLKKDLVDAAVAKKSCVLKTWLEFFAEKNISNEIPSCHSH
IPTVSVEGVSIRVADPKSRENCLKGYTFVLESVHLYKFGDQLNSLLEVAGAKTILFQEFS
SHSQGSEYGDDNRMVCVIPGGGAACKPDFNKLLSSLLKVNEIDIINAALSGELDRSILKS
PCVLISSSCSTDETIVADSDTEVETATSPYASEALCGGNDVKTEELNDDSGISDKRKNER
VEASLDDVSASLHKRKSERMEASIDDISTNLNEIKRAKADISLDASVRSDTHTTIFKDGT
GDIKVKKDKVDDYANGNSDVIYSQNLIVRDINKLTNRSSAPNSSVPNFKRFRKPETQSGN
SFSNLVPFAKYPYKDSDYGKDETAEYVKEEKRRKQREAVADDLFNNQKAKKRGTAGSIHG
ILTR
Download sequence
Identical sequences A0A072UEM0
Medtr5g076180.5 Medtr5g076180.6 Medtr5g076180.7 XP_013454188.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]