SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr6g045403.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr6g045403.1
Domain Number 1 Region: 31-204
Classification Level Classification E-value
Superfamily STI-like 5.98e-33
Family Kunitz (STI) inhibitors 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr6g045403.1
Sequence length 227
Comment | Kunitz type trypsin inhibitor / Alpha-fucosidase | HC | chr6:16328382-16327699 | 20130731
Sequence
MKPTLVTTLCFLLFSFTTYFPLPFTHAGIIVKDIYGKPVVPSGSYFIWPDYLVSGGELRL
GVTENSTCPFTVLQDYSNYGHGFPVKFTPQNQTSSDDPITLGLHLDIAFDYKPVCAESTK
WLVVEAENEYPTPWLAIDGTGKNVYDDGWFELIAYERTGYLIYFCHKLSSTRGECRYISR
KNDKNGMRLVFDDGDYLAAVFVNVDDIVRARGSSIVKKDRAFTLPMI
Download sequence
Identical sequences A0A072U8P1
XP_013452121.1.50012 Medtr6g045403.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]