SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr7g021190.2 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr7g021190.2
Domain Number 1 Region: 636-806
Classification Level Classification E-value
Superfamily HAD-like 4.35e-32
Family NLI interacting factor-like phosphatase 0.011
Further Details:      
 
Domain Number 2 Region: 863-955
Classification Level Classification E-value
Superfamily BRCT domain 3.93e-18
Family BRCT domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr7g021190.2
Sequence length 958
Comment | carboxy-terminal domain phosphatase-like protein, putative | HC | chr7:6664015-6656896 | 20130731
Sequence
MDNLQKEENKDNISRLLSFLKNQHLFTMEHMKKIQVMITVIDSVFALGNNEVVGKEEKVE
ALNTTEQIPGLKADEYISSSQLVHDNSTYASEALQYGQSNVVGRGLMLPLFDLHKDHDLD
SLPSPTREAPSCFPVNKLFSDLGDGIDRFGLPPAVCTEAEKMELDGKDSKLHIYETDALK
AVSTYQQKFSRSSYFTDDKFPSPTPSGDCEGEAVDTNDEVSSASIASSLTSFKPPPLDQI
PVSSTSLDRPNMHGLVDSRIDATGSGSYPAKSSAKSRDPRLRFINPDASTLDLNQSLGTH
SMPRVEYGGRVISRKQKTVEEPSLDATAPKRLRRSLENSEHNTREERAMAGKGGWFEENT
VAGSQLAERNHLMQKGETELKRTISTSSSNLTVSNNGNELASVTSSSATASLPTYLLNNV
AVNPAMLIHMILEHQHNEAEAQKKPVDSARGTDATVNTGPAMTAGLTQSSVGILPASSPA
TSMTQTLPEDSGKIRMKPRDPRRFLHGSSTLQKFDVRVETKLAPIQSIAQPDITRQFTKN
LKNIADIMSVPQETSSNPPATQNVSSASVPFMSDRSEQKSGVPNSQNLKDGVGSAPETCA
PGSSRPQNTWADVEHLFEAYDVKQKAAIQRERSRRLEEQKKMFAARKLCLVLDLDHTLLN
SAKFVEVDPVHDEMLRKKEQEDREKPQRHLFRFPHMGMWTKLRPGVWNFLEKAGKLFEMH
LYTMGNKLYATEMAKVLDPKGVLFAGRVISRGDDAETADTKSKDLEGVLGMESSVVIIDD
SVRVWPHNKLNLIVVERYTYFPCSRRQFGLPGPSLLEIDHDERPESGTLASSLGVIERIH
QNFFASQSLEEVDVRNILASEQRKILDGCRIVFSRMFPVGDANPHLHPLWQTAEQFGASC
TNQIDDQVTHVVAHSPGTDKVNWAIANGKFVVHPGWVEASALLYRRANEQDFAIKLDK
Download sequence
Identical sequences A0A072TXI7
Medtr7g021190.2 XP_013447776.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]