SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr7g021720.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr7g021720.1
Domain Number 1 Region: 7-72
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000103
Family 7-Fe ferredoxin 0.0000948
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr7g021720.1
Sequence length 587
Comment | NAD(P)H-quinone oxidoreductase chain 4 | HC | chr7:6933262-6935123 | 20130731
Sequence
MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGCKRCESACPT
DFLSVRVYLGPETTRSMARAFLAQVYLIFMTNYFPWLTIVVVFPIAVGSLIFLFPHRGNK
VIRWYSISICLIDLLLTTYAFCYHFQLDDPLIQLTENYKWINFFDFYWRLGIDGLSIGPI
LLTGFITTLATLAAQPVTREYQLFYFLMLAMYSGQIGPFSSRDILLFFIMWELELIPVYI
LLAMWGGKKRLYSATKFILYTAGGSVFLLMGILGIGLYGSNEPTLNFETLTNQSYPVALE
IILYTAFLIAFAVKSPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLVRINMELFS
HAHSIFCPWLMILGSTQIIYAASTSFGQRNLKKRIAYSSVSHMGFIILGIGSISDTGLNG
AILQIISHGFIGAALFFLAGTSYDRLHLLYLDEMGGMAIPMLKIFTIFTILSMASLALSG
MSGFVAELIVFFGIITSQKYLFMMKILITFVTAIGMILTPIYLLSILRQMFYGYKFFNTP
NSYFFDSGPRELFISISILIPVIGIGIYPDFIFSFSVDKVEAILANF
Download sequence
Identical sequences G7KTU3
XP_003621689.1.50012 Medtr7g021720.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]