SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr7g039450.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr7g039450.1
Domain Number 1 Region: 338-530
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.34e-48
Family DNA polymerase beta-like 0.0000557
Further Details:      
 
Domain Number 2 Region: 197-278
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 4.71e-20
Family DNA polymerase beta, N-terminal domain-like 0.001
Further Details:      
 
Domain Number 3 Region: 281-335
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 1.5e-16
Family DNA polymerase beta-like, second domain 0.0027
Further Details:      
 
Domain Number 4 Region: 6-101
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000236
Family DNA topoisomerase II binding protein 1, TopBP1 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr7g039450.1
Sequence length 531
Comment | DNA polymerase lambda-like protein | HC | chr7:14670163-14663808 | 20130731
Sequence
MKKKAEQNGMFSGMVVFFVSKGVQARRLQIWKQRMVQMGAVIEDRFSKRVTHVFAVDSHT
LLHEFDGQRLSRFKGSLLLYQWLEDSLKSGEKESEDLYVLKLDPQGEGINELDTSLDPEP
IDGSLSSEPQQLQNKKIKSSSEDAEIVNLKSNEDRRENAPLSLANTASSHGEVEHLNCVD
SRPQHLDSENAASSLPYCPPDLNKKIIEIFGKLVNIYRALGEDRRSFSYYKAISVIEKLP
FKIESADQIKNLPSIGKSMEDHIQEIITTGKLSKLEHFETDEKVQTISLFGEVWGIGPAT
ALKLYEKGHRTLDDLRNDDSLTNAQKLGLKYFDDIRHRIPRHEVQEMEQILQKVGENVLP
GVTIICGGSYRRGKATCGDIDIIVTHPDGTSHKGFLPKFVKRLKDMSFLREDLIYSTHSE
EGTDSGVDTYFGFCTYPGRELRHRIDLKVYPRDIYAFGLVAWTGNDVLNRRLRQQAESKG
FRLDDTGLFPAIQGSGGKRGTKGTANMKLYTEKEVFEFLGFPWLEPHERNL
Download sequence
Identical sequences A0A072TY09
XP_013448290.1.50012 Medtr7g039450.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]