SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr7g073580.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr7g073580.1
Domain Number 1 Region: 1-47
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000715
Family Protein kinases, catalytic subunit 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr7g073580.1
Sequence length 93
Comment | Serine/Threonine kinase domain protein | HC | chr7:27507572-27508548 | 20130731
Sequence
MRQIITSLKKIHDTGTVHRDIKPSNLVVTKLGRIKFVDFGAATDLRILFPLNCIFYHKKH
QVFLHSQLQLYFHHIVAVKQSLELCSFKWQYQP
Download sequence
Identical sequences A0A072U1G9
Medtr7g073580.1 XP_013449259.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]