SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr7g091010.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr7g091010.1
Domain Number 1 Region: 35-84
Classification Level Classification E-value
Superfamily BRCT domain 0.000000474
Family BRCT domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr7g091010.1
Sequence length 107
Comment | hypothetical protein | LC | chr7:35899879-35901382 | 20130731
Sequence
MDAIKILASGFDCPCLHVPILLRRVVKIDELMSDIVIVKNVLAPEYKAKDWSHINIVTVK
WFDESIAQRACLNEESYPVQSGSLSSNVPLFVKEADAEAPPFITDQQ
Download sequence
Identical sequences G7KSM6
Medtr7g091010.1 XP_003625108.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]