SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr7g091020.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr7g091020.1
Domain Number 1 Region: 4-62
Classification Level Classification E-value
Superfamily BRCT domain 0.000000311
Family DNA topoisomerase II binding protein 1, TopBP1 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr7g091020.1
Sequence length 254
Comment | hypothetical protein | HC | chr7:35901470-35902773 | 20130731
Sequence
MEKLSKGGGSQCLYLNDKLTHIVVGNPTEMEREDVARTVARGVYYAVKTSWLEDCDREKK
QVHVLQRYNAYDIVFPKGQKKLVEVSDRIKKKNLEKKELTKAHVDLAQVLVDYAASRRLA
RTRVCFEIVELKRRQKEMEMEYVRIHDDLREKLGPLYGYQKPKNELKIEAYKLYEEDCKS
KGIAAISKHHEMGFKKAMEAFGDIAKESCRCNFVTYLNDPVRKENIENHFKGMILKFPGD
KTDPDVAKFVSKFV
Download sequence
Identical sequences G7KSM7
Medtr7g091020.1 XP_003625109.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]