SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr7g098170.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr7g098170.1
Domain Number 1 Region: 475-562
Classification Level Classification E-value
Superfamily BRCT domain 2.18e-24
Family BRCT domain 0.0025
Further Details:      
 
Domain Number 2 Region: 29-92
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000203
Family RING finger domain, C3HC4 0.0053
Further Details:      
 
Domain Number 3 Region: 586-684
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000667
Family BRCT domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr7g098170.1
Sequence length 687
Comment | breast cancer susceptibility protein, putative | HC | chr7:39230788-39237133 | 20130731
Sequence
mensgksimnnntkllnpwmlhfqklalelkcplclnlfkkpvllpcnhlfcsscladst
sirsecalcntkcsqkdirhlpfvesivtiyksldatfcanafqqrssdntrvleqcqtl
hnsafsnkvdkvlqnscmsnevgvgknhqsgikmngkakevemsckrgadnhiaekpdsm
nlnqatqsepdsppfcdtkgsdngcsdlnsekplslgrsesssfkrssttgkgnlkermp
hfwsessasenedltrdlkrqknltnedgivqqstsyhnklvdsrcdleiksdkdtgalv
psnapsdlypstsicsfcqsskiseatgsmlhyasgisvtgeaamepnvvhvhkvcidwa
pqvyfvgetvknlkaevargaklkctkcgkkgaalgcyvkscrrtyhvpcamdisacrwd
hvdylllcpshsnvkfpneksnldkqatqkhpvsshlpsqqsnqlgavqgdgkkmvfcgs
alsneekvllinfaskvgatvskcwtsdvthviaatdangacsrtlkvlrailngqwilk
mdwiracmkamnlveeelyeidldnqgcqggpkagrlralanepklfsglkfyfsgeyds
sykkyledlveggggvvlkskdelevgrdanllavynldppegceledevsilwhrltea
enltantaghtwilesiaacklqpfvs
Download sequence
Identical sequences G7KXD0
XP_003625346.1.50012 Medtr7g098170.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]