SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr7g100040.2 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr7g100040.2
Domain Number 1 Region: 223-313
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000000218
Family DNA ligase 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr7g100040.2
Sequence length 487
Comment | pescadillo-like protein | HC | chr7:40201194-40205320 | 20130731
Sequence
MPLSLSPGHKHSSSFKSVYPFSVPATESKKIDVELVHKCRRLAHEWQAFVSRTHKLRKTF
VSVKGIYYQAEVEGQKITWLTPHSLQQVVSEDVDIPTMLNFLQLYEPLLCFVNFHLYHSI
NLKYPPMLDPRLEALAADIYALSRYLNGNTRPAILNSETSQLVESEQLESKQDGAQTQNE
KSELRLAQLQHQLPSNEPGALMQLVEKVAGEGEEEYDQETRECKNLFRNVKIFLSREAPR
ESLLFVIPAFGGTVSWEGEGAPFAESDQSITHQIVDRESQGHRFLSREYVQPQWVFDCVN
ARIILPTDNYFVGRIPPPHLSPFVDYDEGAYVPEYAKTLKHLQAAARKEVLPLPGAEKDL
EDPQNLLAEGIIDRAAANEAAEKKQKLMKQEQRFREELKKELKGETYTSAGSAVEKETST
AVIETGESTNNVQANTDDGAEMGKLLLSRRKRKLLEAMQISNERKKNKHDTIIKRKKKLD
EAQNQRS
Download sequence
Identical sequences G7L0M2
XP_003625519.2.50012 Medtr7g100040.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]