SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr7g107100.4 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr7g107100.4
Domain Number 1 Region: 57-99,302-537
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.29e-71
Family FolH catalytic domain-like 0.0000375
Further Details:      
 
Domain Number 2 Region: 105-320
Classification Level Classification E-value
Superfamily PA domain 2.88e-44
Family PA domain 0.00012
Further Details:      
 
Domain Number 3 Region: 539-634
Classification Level Classification E-value
Superfamily Transferrin receptor-like dimerisation domain 5.36e-19
Family Transferrin receptor-like dimerisation domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr7g107100.4
Sequence length 650
Comment | glutamate carboxypeptidase, putative | HC | chr7:43671757-43677558 | 20130731
Sequence
MTTKPNNLLTTKPSPLTTMVVFLILCILGFYAFHFPHTPPHSNNTSTFQNLFLSSSSNST
ISSYLRTLTMHPHLAGTKPNSDTANFVLNHFISLNLKTHTTSYNVLLSYPLHSSLSMHFN
DGSSSNLGLTEPGSSGSDMVHAYHAYSPSGSVYAKAVFVNYGRDRDYRAVGVSIKGCIVI
VRKGGGLGRNTVVEKAEENGAVAVLVYNDENDTWRNGFERGHVMKGVGDPLSPGWGSVEG
SEKLSLDDNEVLKRFPKIPSMPLSAHVADAVLSSLGVTPLPLEWRTTLRAKGINHVGPGP
TMLNFTYLGEKKMATIQNVFAVIKGSEEPDRHVLLGNHRDAWTYGAVDPSSGTAALLDIA
RRYSILLHSGWKPRRTIVLCSWDAEEFGMIGSTEWVEQNLINLGSKAVAYLNVDCAVQGP
GFFVGSTPQLDSLILEITKKVKDPDSKGVSVYASWAAANGGNNIQRLGRVDSDFAPFVQH
AGVPSIDIYYGKDFPVYHTAFDSYNWMAEYADPFFQRHVAVTGIWGLLALRLADDSILPF
NYLSYANELRLYRDKLSNMLDHKMSLHPLTTSIQEFACAAKEVDDELKELKLVETSGQFV
DMKRRAMNDRLMLAEKGFLDGDGLKGKQWFKHLVSFVYLLICTLENSLPV
Download sequence
Identical sequences A0A072U3L2
Medtr7g107100.4 XP_013450284.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]