SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr7g109980.2 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr7g109980.2
Domain Number 1 Region: 4-113
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.12e-24
Family CC0527-like 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr7g109980.2
Sequence length 120
Comment | dihydroorotate dehydrogenase, putative | HC | chr7:45063708-45065493 | 20130731
Sequence
MSDFVYRISTAKEWEELQRNGSTFGGELDKSSSFIHLSKLEQVRSTLDNFFLNSKDELYL
LQIDAKKLGDGLVYEIVDGSNSFPHFYGPSRSFIPLPLDVVTKAEELSLSNGRFSCSLLD
Download sequence
Identical sequences G7KTP9
Medtr7g109980.1 Medtr7g109980.2 XP_003626011.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]