SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr8g042540.3 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Medtr8g042540.3
Domain Number - Region: 23-81
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000922
Family B3 DNA binding domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr8g042540.3
Sequence length 100
Comment | hypothetical protein | HC | chr8:16395831-16398281 | 20130731
Sequence
MYIGSLAQLSPLHITWELAYNGFCELILDRRTTALKLVDDCGNKWDCTLIFDSRPYPHFP
VGGGFHRMILARRLRDGCHVMVGAPGVGSNDTLYFRIVRY
Download sequence
Identical sequences A0A072TP60
XP_013445171.1.50012 Medtr8g042540.2 Medtr8g042540.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]