SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr8g066490.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Medtr8g066490.1
Domain Number - Region: 14-59
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00663
Family 7-Fe ferredoxin 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr8g066490.1
Sequence length 65
Comment | hypothetical protein | LC | chr8:27659358-27657613 | 20130731
Sequence
MVSSLSPNSNLGLQHCGSKPIWLDMWKTRAFFSAVSTNLPSQNHWECWWVSVCAYGCPMC
TTGWA
Download sequence
Identical sequences G7LGZ2
Medtr8g066490.1 XP_003628765.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]