SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr8g068900.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Medtr8g068900.1
Domain Number - Region: 97-164
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000534
Family Protein kinases, catalytic subunit 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr8g068900.1
Sequence length 176
Comment | hypothetical protein | LC | chr8:28834057-28831258 | 20130731
Sequence
MQIHDNVEQANVNVNNAFGADVVTNVVESGGRGGNVDLNGSLRNPSSDNDEGNSSRAEFD
DDDDGQDAGKDDDGGGDFDDGQDFIGALDGGKACGPGTGRMVSVKENFCSSSHLKDRTKI
AVLSMFVTNIIVSHLGYSIEGNEKNLLCEYMPLGALSQNLFSLEKIGLKKFVLKRS
Download sequence
Identical sequences G7LIL3
Medtr8g068900.1 XP_003628903.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]