SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr8g075310.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr8g075310.1
Domain Number 1 Region: 54-240,328-417
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.41e-81
Family Bacterial dinuclear zinc exopeptidases 0.000000373
Further Details:      
 
Domain Number 2 Region: 234-320
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.00000000000000478
Family Bacterial exopeptidase dimerisation domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr8g075310.1
Sequence length 425
Comment | IAA-amino acid hydrolase ILR1-like protein | HC | chr8:31839826-31836958 | 20130731
Sequence
MMGPKNHPRLTLLPIFLFLFHPTCLSSTTYQTKECSNQTSSLKSEILELANTPNTVKWMK
NIRREIHEYPELAYEEFKTSSVIRRELDKLGVVYQWPVAKTGVVAKVGSGFAPFVALRAD
MDALPIQELVDWDHKSKVDGKMHACAHDAHVAMLLGAAKILQEMKDKLKGTVVLIFQPAE
EKGTGAKDMIQENVLEDVEAIFGLHLASLYPLGVVASRPGEFLAGYGSFKAKIKGGLAGT
PQRCLDPILAASASVISLQNIISREVDPLDSQVLSVAMIQSESGHELTPDSVTFGGTYRA
FSKKSFNALRNRIEEVIKGQEHPTIPPTTNDERIYQLARKVSSMIVGEENIKLSPIVTGS
EDFAFYLEKVPGSFFFLGIKNEKSGSIYSAHSPQFFIDEDVLPIGAAIHAAFALSYYSYS
TNSYL
Download sequence
Identical sequences G7LB81
Medtr8g075310.1 XP_003629278.2.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]