SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr1988s0010.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Medtr1988s0010.1
Domain Number - Region: 56-183
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00863
Family SMI1/KNR4-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr1988s0010.1
Sequence length 249
Comment | hypothetical protein | HC | scaffold1988:384-1131 | 20130731
Sequence
RLPFVVEGCRQATAKTRPTTPAPAPMQATDFPDTELADLRAHGIVLFADRVIFDAQPPMP
ADQIAAVQARCHGDLPPALLELWRTTAGGSLDYDLTLEMNGHIEAIGWGELFYNGSNGYR
DLDGWIDHELELAEEAADEHSRPWSGRLDVLPFGGFEYCDRIYIVTDPDAKDRGHVLAWK
QGLPPAWRGAMHEDGLATVAPDLYAAFGALQLNADPLEPGGENGTGATLLDYIDARQAEH
GLSASLGDK
Download sequence
Identical sequences A0A072TNJ8
XP_013441135.1.50012 Medtr1988s0010.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]