SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr1g053960.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr1g053960.1
Domain Number 1 Region: 160-234
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000789
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 2 Region: 259-289
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000366
Family CCCH zinc finger 0.0016
Further Details:      
 
Domain Number 3 Region: 94-125
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000222
Family CCCH zinc finger 0.0025
Further Details:      
 
Domain Number 4 Region: 31-57
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000602
Family CCCH zinc finger 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr1g053960.1
Sequence length 293
Comment | zinc finger C-x8-C-x5-C-x3-H type family protein | HC | chr1:22947319-22950793 | 20130731
Sequence
MDARKRGRVDAALNGSVKKTKQEMDSTGVGSKTKPCTKFFSIAGCPFGEGCHFSHHVPGG
YNAVAQMMNLKPAAPPRNVAAPPPVSNNGSAQHAVKSRICNKFNSLEGCKFGDKCHFAHG
EWELGKPFAPSVDDHRLMAPTNVGRMPGRVEAPSGLGGTSFGANSTAKISVEASLAGAII
GKGGVHSKQICRQTGVKFSIRDHETDPNLRNIELEGTFDQIAQASNMVKDLLLTLSVSAP
PKSTPGAPAGGGPAAPGRNIKTKLCENFAKGSCTFGERCHFAHGAAELRKLGV
Download sequence
Identical sequences A0A072VIQ3
XP_013467665.1.50012 Medtr1g053960.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]