SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr1g069260.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr1g069260.1
Domain Number 1 Region: 212-273
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000137
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr1g069260.1
Sequence length 289
Comment | transmembrane protein, putative | LC | chr1:29836507-29837560 | 20130731
Sequence
MYNNDVHALLSYHAMTGNSGTLNIMMFHALSFINLAYLPIYVAGPLDPNPVFELDRIVND
LRKKYRTYVVPYSGEHGVAVLPPMFGHDFGDQIGRYATLIDGNNNKFEVLISLGCWVSMF
FVGESKFEITLEDRFRRRMANPRFTPSMKFEIDKDMLPFLMIDDVPRPYVHDPMNFQFSY
EKKLNGDEIDSGWLYYSNSYTFVLIQILAAGEFCRLTLNKRSTSVKLVDDFGNAWFCTLV
YGRRKYAHFKIGGSWRRMVKARGLQRGSHLILGAPKIGNNDTVYFSLIC
Download sequence
Identical sequences A0A072VLG0
XP_013468394.1.50012 Medtr1g069260.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]