SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr2g011170.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g011170.1
Domain Number 1 Region: 485-772
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.05e-79
Family Protein kinases, catalytic subunit 0.0000567
Further Details:      
 
Domain Number 2 Region: 72-180
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.01e-29
Family alpha-D-mannose-specific plant lectins 0.0051
Further Details:      
 
Weak hits

Sequence:  Medtr2g011170.1
Domain Number - Region: 344-414
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0157
Family Anti-platelet protein 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr2g011170.1
Sequence length 817
Comment | S-locus lectin kinase family protein | HC | chr2:2677200-2681013 | 20130731
Sequence
mkvlivifvyvclsmldkasyaadtltqnssiidgqelisagqifclgffspgsskkyyl
giwyknitpqtvvwvanrekplnnssgnltigadgnillvdgvgnkiwytnssrsiqepl
aklldsgnlvlmdgknhdsnsyiwqsfdyptdtmlpgmklgwdkasgldryltswksadd
dpsygsftynfdhkefaelvihqgknitfrsgiwngvrfnsddwtsfigvtafkpqlsvt
knevvywdepgdrlsrfmmrddglleryiwdssivkwtkmyearkdlcdnygacgingvc
niddvpvycdclkgfkprsqdewnsfnrsggcirktplncteadrfqklssvklpmllqf
wtnssmsleeckveclkdcsctayansvinegphgcliwfgdlidirlfisedslqldly
vrlaaseiestasaskrrkmaliisvsmavfvlciifyicmkyakvrkqkttadlghrnq
nekqasplfdidtilaatdsfsienkigqggfgpvykgilaqgqeiavkrlsktskqgvt
efmnevglvaklqhrnlvsvlggctygnermlvyeympngslnhfifdptqgkflqwrkr
ydiimgvargllylhqdskltiihrdlktsnilldseliakisdfgvshilegdssavtt
nkivgtigymspeyavngllslksdvfsfgvivleilsgirnnhfknqdhphnllgqawi
lwkegralefmdanldltsipsellrclqigllcvqkfpedrpdmssvvfmlgnesiala
qpkkpgffseeiefhessekdtfsnntmtitlleard
Download sequence
Identical sequences G7IK52
Medtr2g011170.1 XP_003593411.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]