SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr2g067980.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g067980.1
Domain Number 1 Region: 25-247
Classification Level Classification E-value
Superfamily Osmotin, thaumatin-like protein 9.55e-73
Family Osmotin, thaumatin-like protein 0.00000179
Further Details:      
 
Domain Number 2 Region: 726-1013
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.03e-69
Family Protein kinases, catalytic subunit 0.00026
Further Details:      
 
Domain Number 3 Region: 295-430
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.03e-20
Family alpha-D-mannose-specific plant lectins 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr2g067980.1
Sequence length 1033
Comment | lectin kinase family protein | HC | chr2:28442220-28446111 | 20130731
Sequence
MVKPMSFLFFVTFHLSITSVVFAAEFTIINNCNYTVWPASYTTGGNSENATLPTTGFMLK
PGDNLTITTPAKWTGRFWGRTLCTTDSVSKNFSCVTGDCGSGKVACDGRSGSPPVTLAEI
SLDSANNQDFYDVSLVDGYNVPMELVPLGGSGKCNSTGCPTDLNAVCPTELKVTQNGTVV
ACQGPCAAFNLQFFCCAGNHSTPSTCEPSVYAQIFKTTCPQAYSYTYDDKTSTFTCPATD
YHVVFCPASNNASLESLDQGVIVGESLIAGSGTTRWFSPSGDFSFGFYQLPNELFLLAIW
YDKIQDDAIIWYANGNNPAPKGSRLILNDSHGLVLTNPQGLELWSSDFTSGTISNGLMND
DGNFQLRDKNNVTIWDSFSHPTDTLVPNQVMELNGNLSSRQGSFNFSQGRFKLHLQEDGN
LVLNLVNLPSNYSYKPYYSARTSDSKNQTNIGQRLIFDESGLLYIEKKGGDNFSISNPNG
TFSTDDFYYKATINFDGVFTIAFYPKDPKRGQSWVIAKTIPENICLYSTYTNGEGVCGFN
SICTLTNDQRPNCTCPVGYSPIDSNNMYLGCIPNFQVICQAGGNWDSQKDLYTMKELPNT
DWPESDYEIISPSSLQECKESCLRDCLCVLVSFNQSSCWKKKLPLSYGRNDQGVKGISIM
KLMNNDPLSSLSALSNGKKDHDTLIIVISVLLGSSVFVILTLLGAIFFGFPYNLKKIKSS
RTNKSVVDNNLRSFSFKEIVDATHNFREELGRGSCSIVYKGTIEMMINVAVKKLDKLIQD
SDKEFKTEMSVIGQTHHRNLVRLLGYCNEGQHRILAYELMSNGTLASFLFTPLKPDWNQR
VHIILGIARGLVYLHEGCCTQIIHCDIKPQNILLDDQYNARISDFGLAKLLLINQSHTET
GIRGTKGYVAPDWFRSAPITAKVDTYSFGVLLLEIICCRKNVEKEFFTEEKGILTDWAYD
CYKTKRLDILLEKDNEASNDMMCLEKFVMIAIWCIQEDPSLRPTMKKVLLMLEGIVEVAA
PPSPYLYGSVSSN
Download sequence
Identical sequences A0A072V8H5
XP_013464289.1.50012 Medtr2g067980.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]